PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA6838
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 966aa    MW: 106980 Da    PI: 5.5348
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA6838genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-28601651252
                    RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                               ek++sl++l++yFs+++kdAAk++gvc+T+LKriCR++GI+RWP+Rki+++
  Tp57577_TGAC_v2_mRNA6838 601 EKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRHHGISRWPSRKINKV 651
                               89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.768585671IPR003035RWP-RK domain
PfamPF020428.4E-26603651IPR003035RWP-RK domain
SuperFamilySSF542774.91E-21857949No hitNo description
Gene3DG3DSA:3.10.20.2405.1E-23862944No hitNo description
SMARTSM006665.0E-22865947IPR000270PB1 domain
PROSITE profilePS5174519.171865947IPR000270PB1 domain
PfamPF005645.0E-17867946IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 966 aa     Download sequence    Send to blast
MEYPFYPKGR GIGYWQSPGT QLEESRSLDG GISNLGSEDM PSSFSELMNF DTYAGLCSGP  60
SMTDQIMANE LPSLASVLYQ SPDEFNLVEQ NTGQFYMTGV SGNYNNSESS PIFGEKIVRQ  120
QMDSLLDLLD NNNDANNLSS KQKINDSSQH VNTFDMDNCI ISKPPDLSLD ERMLKALSFF  180
KESAGGGILA QVWVPIKHGG QVYLSTSEQP YLLDQMLAGY REVSRTFTFS TEGKPGFLPG  240
LPGRVFISKV PEWTSNVGYY SPSEYLRVEH ARNHDVRGSI AFPIFDLHSG LPCCAVLELV  300
TTKEKLDFDR ELEIICRSLQ LVNLRTTMPF RLLPECLTNN KRAALTEIVD VLRSVCHAHR  360
LPLALTWIPC FYNEGTRDET TRIQIKEGNS SSREKNILCI EESACYITDR AMEGFVHACI  420
EHPLEEGKGV AGKALQSNHP FFYSDVKTYD ISEYPLVHHA RKFNLNAAVA IRLRSTYTNN  480
DDYILEFFLP INMKGSSEQQ LLLDNLSGTM QKICKSLRTV SGAELSEMES SQEGFEKNSV  540
PSFPPSSKRK SPTPFINESH GSVKKLSSKA SNLRNNGNEP SPNQERNAPK RRAEKYRSSS  600
EKNVSLSVLQ QYFSGSLKDA AKSIGVCPTT LKRICRHHGI SRWPSRKINK VNRSLKKIQT  660
VLDSVEGVEG GLKFDPSVGA FVAKGTAIQE IDENRSLPFP EKSTTEDSEP FSQDAASVPL  720
AHCSDGENSA NKLDEKLKET NASLIDCSED SKSFAMDDCP EQACFGSVLG KGDQWVLNKG  780
GLREEEKCKH NTIGKRTSSF VVYEMDTGVD GDDEAVENNN PASSSLTGSS NSSGSIVHDS  840
SSGYQNLKNQ KQSKSKSIIV DSGSKIVVKA TYGEDTIRFK FDPATGCLKL YEEVASRFKL  900
RNGTFQLKYL DDEKEWVMLV NDSDLQECLE ILNDMGTRNA RFLVRDTPCT FGSSGSSVCY  960
LGGSS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012571480.10.0PREDICTED: protein NLP8-like
RefseqXP_012571482.10.0PREDICTED: protein NLP8-like
RefseqXP_012571483.10.0PREDICTED: protein NLP8-like
RefseqXP_012571487.10.0PREDICTED: protein NLP8-like
TrEMBLG7IS090.0G7IS09_MEDTR; Plant regulator RWP-RK family protein
STRINGGLYMA15G03225.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein